Active human MRP8 full length protein
| Name | Active human MRP8 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab167749 |
| Category | Protein |
| Prices | $302.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . ab167749 was lyophilized from 0.22 µm filtered solution. |
| Bioactivity | Determined by its binding ability with Human CEACAM3 protein in the presence of 100 mM CaCl 2 . |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P05109 |
| Gene | S100A8 |
| Residue | 1 to 93 |
| Sequence | MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKG ADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab167749 and staining overnight with Coomassie Blue.