Human LEC full length protein
| Name | Human LEC full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab193752 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Mammalian |
| Tag/Conjugation | StrepII tag C-Terminus |
| Purity | >95% by SDS-PAGE . Purified from chemically-defined, serum- and animal-product-free culture medium |
| Endotoxin | < 0.200 Eu/µg |
| SwissProt/Accession | O15467 |
| Gene | CCL16 |
| Residue | 24 to 120 |
| Sequence | QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNR EVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab193752 at 2 μg