Human Macrophage Inflammatory Protein 4 protein fragment
| Name | Human Macrophage Inflammatory Protein 4 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab101822 |
| Category | Protein |
| Applications | SDS-PAGE MS |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 95 % by SDS-PAGE. purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P55774 |
| Gene | CCL18 |
| Residue | 22 to 89 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSHM QVGTNKELCCLVYTSWQIPQKFIVD YSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
| Supplier Page | Shop |
Product images
SDS Page analysis of ab101822 (3ug)