Human Macrophage inflammatory protein 5 full length protein
| Name | Human Macrophage inflammatory protein 5 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab105617 |
| Category | Protein |
| Applications | SDS-PAGE MS |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 95 % by SDS-PAGE. ab105617 was purified using conventional chromatography techniques. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q16663 |
| Gene | CCL15 |
| Residue | 22 to 113 |
| Sequence | MQFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSY FETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of 3µg ab105617.