| Name | Active human NGF full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab179616 |
| Category | Protein |
| Prices | $202.00 |
| Sizes | 20 µg |
| Applications | HPLC SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 97 % by SDS-PAGE. assessed by HPLC, Reducing and Non-reducing SDS-PAGE, UV spectroscopy at 280 nm. Note: This product is produced with no animal-derived raw products, animal free equipment and animal free protocols. |
| Bioactivity | The activity is determined by the ability to stimulate proliferation of TF-1 cells and is typically less than 1 ng/mL. |
| Endotoxin | <=1.000 Eu/µg |
| SwissProt/Accession | P01138 |
| Gene | NGF |
| Residue | 122 to 241 |
| Sequence | SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFK QYFFETKCRD PNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAA WRFIRIDTACVCVLSRKAVRRA |
| Supplier Page | Shop |