Human MCP2 full length protein

Name Human MCP2 full length protein
Supplier Abcam
Catalog ab151887
Category Protein
Applications HPLC SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Tag/Conjugation His tag C-Terminus
Purity >95% by SDS-PAGE . ab151887 has greater than 95% purity as determined by RP-HPLC and reducing and non-reducing SDS-PAGE.
Endotoxin < 0.100 Eu/µg
SwissProt/Accession P80075
Gene CCL8
Residue 24 to 99
Sequence QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKE VCADPKERWVRDSMKHLDQIFQNLKP
Supplier Page Shop