Active human Osteoprotegerin protein fragment
| Name | Active human Osteoprotegerin protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab157265 |
| Category | Protein |
| Prices | $410.00 |
| Sizes | 50 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Binds human and mouse RANKL and TRAIL. Inhibits rhsTRAIL-mediated apoptosis at a concentration range of 5-20µg/ml, as well as rhsRANKL-induced osteoclastogenesis and stimulation of dendritic cells. Concentrations of ab157265 required to inhibit may vary depending on the cell type studied and on the concentration of rhsTRAIL used to kill the cells. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | O00300 |
| Gene | TNFRSF11B |
| Residue | 22 to 202 |
| Sequence | ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYT DSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKH RSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGL LLTQKGNATHDNICSGNSESTQKCGIDVTLC |
| Supplier Page | Shop |
Product images
Inhibition of TRAIL- mediated apoptosis: ab157265 exerts its inhibitory activity in a concentration range of 5-20µg/ml.