Human MelanA protein fragment
| Name | Human MelanA protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab157272 |
| Category | Protein |
| Applications | MS SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 85 % by SDS-PAGE. ab157272 was purified using conventional chromatography techniques. |
| SwissProt/Accession | Q16655 |
| Gene | MLANA |
| Residue | 48 to 118 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSCRRRNGYRALMDKSLHVGTQCALTRRC PQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of ab157272 (3µg).