Human Metabotropic Glutamate Receptor 1 protein fragment
| Name | Human Metabotropic Glutamate Receptor 1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114707 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | Q13255 |
| Gene | GRM1 |
| Residue | 387 to 486 |
| Sequence | NPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHV GLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab114707 at approximately 36.63 kDa stained with Coomassie Blue.