Human Metabotropic Glutamate Receptor 3 protein fragment
| Name | Human Metabotropic Glutamate Receptor 3 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114583 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | Q14832 |
| Gene | GRM3 |
| Residue | 21 to 120 |
| Sequence | LSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLE AMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab114583 at approximately 36.63kDa stained with Coomassie Blue.