Active human Parathyroid Hormone Receptor 1 protein fragment
| Name | Active human Parathyroid Hormone Receptor 1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab182670 |
| Category | Protein |
| Prices | $357.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its binding ability in a functional ELISA. When ab182670 is used at 2 µg/ml, the concentration of biotinylated PTHrP that produces 50% of the optimal binding response is found to be approximately 0.1 - 0.25 µg/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q03431 |
| Gene | PTH1R |
| Residue | 27 to 188 |
| Sequence | DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSG KPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEV VAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTN ETREREVFDRLG |
| Supplier Page | Shop |
Product images
The purity of ab182670 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue.