TRPA1 Recombinant Protein (Human) (OPCA04252)

Name TRPA1 Recombinant Protein (Human) (OPCA04252)
Supplier Aviva Systems Biology
Catalog OPCA04252
Category Protein
Species Reactivities Human
Nature Recombinant
Tag/Conjugation N-terminal 6xHis-SUMO-tagged
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession O75762
Gene TRPA1
Sequence Partial: IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP
Description Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function.
Supplier Page Shop