RBX1 Recombinant Protein (Human) (OPCA04759)

Name RBX1 Recombinant Protein (Human) (OPCA04759)
Supplier Aviva Systems Biology
Catalog OPCA04759
Category Protein
Species Reactivities Human
Nature Recombinant
Tag/Conjugation N-terminal GST-tagged
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P62877
Gene RBX1
Sequence Full Length : MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Description E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair
Supplier Page Shop