VDP p115 Recombinant Protein Antigen

Name VDP p115 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-55590PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody VDP p115 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene USO1
Sequence DNSLESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEE
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to VDP p115
Supplier Page Shop