CHM fusion protein
| Name | CHM fusion protein |
|---|---|
| Supplier | Proteintech Group |
| Catalog | Ag23166 |
| Category | Protein |
| Species Reactivities | Human |
| Source | E. coli -derived, PGEX-4T |
| Tag/Conjugation | GST |
| Purity | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Bioactivity | Not tested. |
| Endotoxin | Please contact the lab for more information. |
| Gene | CHM |
| Sequence | VSDSPVWQDQILENEEAIALSRKDKTIQHVEVFCYGRSTLLL (69-110 aa encoded by BC063522 ) |
| Supplier Page | Shop |
Product images
