Active human PDGF BB full length protein
| Name | Active human PDGF BB full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab155718 |
| Category | Protein |
| Prices | $239.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The bio-activity was determined by dose-dependent stimulation of the proliferation of mouse 3T3 cells. ED 50 was 1-10 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P01127 |
| Gene | PDGFB |
| Residue | 82 to 191 |
| Sequence | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCS GCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCE TVAAARPVTR |
| Supplier Page | Shop |
Product images
SDS-PAGE of reduced ab155718 stained overnight with Coomassie Blue. M: Marker +: Reduced (DTT) -: Non-reduced (no DTT)