| Name | Active human PDGF BB full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191740 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The ED 50 was determined by the dose-dependent proliferation of Balb/c 3T3 cells.The expected ED 50 for this effect is 1.0-3.0 ng/ml, corresponding to 1.0 x 10 6 IU/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P01127 |
| Gene | PDGFB |
| Residue | 82 to 190 |
| Sequence | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCS GCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCE TVAAARPVT |
| Supplier Page | Shop |