Human OATP2 protein fragment
| Name | Human OATP2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112394 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB Array |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | useful for Antibody Production and Protein Array |
| SwissProt/Accession | Q9Y6L6 |
| Gene | SLCO1B1 |
| Residue | 481 to 570 |
| Sequence | YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDAC TRKFYFFVAIQVLNLFFSALGGTSHVMLIVKIVQPELKSL |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE analysis of OATP2 protein (ab112394), stained with Coomassie Blue.