Active human PLGF full length protein
| Name | Active human PLGF full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab174025 |
| Category | Protein |
| Prices | $414.00 |
| Sizes | 20 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured in a cell proliferation assay using MDA - MB – 231 Human breast cancer cells. The ED 50 for this effect is typically 1 - 10 µg/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P49763 |
| Gene | PGF |
| Residue | 19 to 170 |
| Sequence | LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSE VEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYV ELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVP RR |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab174025 stained overnight with Coomassie Blue. DTT-reduced Protein migrates as 28-33 kDa due to glycosylation.