Human p57 Kip2 protein fragment
| Name | Human p57 Kip2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112270 |
| Category | Protein |
| Applications | Array WB ELISA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | useful for Antibody Production and Protein Array |
| SwissProt/Accession | P49918 |
| Gene | CDKN1C |
| Residue | 1 to 100 |
| Sequence | MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARL AELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE Stained with Coomassie Blue.