Human PD1 protein fragment
| Name | Human PD1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab180060 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q15116 |
| Gene | PDCD1 |
| Residue | 21 to 167 |
| Sequence | SGWLLEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRL SPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGI YLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab180060 in DTT-reduced (lane 1) and non-reduced (lane 2) conditions. Gel stained overnight with Coomassie Blue. As a result of different glycosylation, DTT-reduced protein migrates as 55-66 kDa and non-reduced protein migrates as 110-140 kDa.