Human Perforin protein fragment
| Name | Human Perforin protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112345 |
| Category | Protein |
| Applications | SDS-PAGE ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | useful for Antibody Production and Protein Array |
| SwissProt/Accession | P14222 |
| Gene | PRF1 |
| Residue | 461 to 555 |
| Sequence | WSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRC NLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab112345 at approximately 36.08kDa stained with Coomassie Blue.