Active human R3 IGF1 full length protein

Name Active human R3 IGF1 full length protein
Supplier Abcam
Catalog ab58750
Category Protein
Prices $157.00
Sizes 100 µg
Applications FA
Species Reactivities Human
Nature Recombinant
Source E. coli
Bioactivity This protein has been shown to stimulate protein synthesis in L6 myoblasts at an ED 50 of ≤ 10 ng/ml.
SwissProt/Accession P05019
Gene IGF1
Residue 1 to 71
Sequence GPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPAKSA
Supplier Page Shop