Name | Active human R3 IGF1 full length protein |
---|---|
Supplier | Abcam |
Catalog | ab58750 |
Category | Protein |
Prices | $157.00 |
Sizes | 100 µg |
Applications | FA |
Species Reactivities | Human |
Nature | Recombinant |
Source | E. coli |
Bioactivity | This protein has been shown to stimulate protein synthesis in L6 myoblasts at an ED 50 of ≤ 10 ng/ml. |
SwissProt/Accession | P05019 |
Gene | IGF1 |
Residue | 1 to 71 |
Sequence | GPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPAKSA |
Supplier Page | Shop |