Human Phospholamban protein fragment
| Name | Human Phospholamban protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114227 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P26678 |
| Gene | PLN |
| Residue | 1 to 30 |
| Sequence | MEKVQYLTRSAIRRASTIEMPQQARQKLQN |
| Supplier Page | Shop |
Product images
ab114227 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.