| Name | Active human RAP80 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab189671 |
| Category | Protein |
| Prices | $519.00 |
| Sizes | 250 µg |
| Applications | Purification FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Use 50-100 μg of protein to pull down 10-20 μg of purified K63-linked ubiquitin chains. The amount necessary for use in crude lysates needs to be determined empirically. |
| SwissProt/Accession | Q96RL1 |
| Gene | UIMC1 |
| Residue | 79 to 124 |
| Sequence | MTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNSCRPS |
| Supplier Page | Shop |