Active human REG4 full length protein
| Name | Active human REG4 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab182679 |
| Category | Protein |
| Prices | $357.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by the ability of the immobilized protein to support the proliferation of HCT-116 Human colorectal carcinoma cells (ATCC: CCL-247) under low serum conditions. The ED 50 for this effect is typically 3-15 μg/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q9BYZ8 |
| Gene | REG4 |
| Residue | 23 to 158 |
| Sequence | DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILS LKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKS MGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP |
| Supplier Page | Shop |
Product images
The purity of ab182679 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue.