Human PIGW protein fragment
| Name | Human PIGW protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab166161 |
| Category | Protein |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | Q7Z7B1 |
| Gene | PIGW |
| Residue | 399 to 447 |
| Sequence | KFLIKGALVPCSWKLIQSPVTNKKHSESLVPEAERMEPSLCLITALNRK |
| Supplier Page | Shop |
Product images
ab166161 on a 12.5% SDS-PAGE stained with Coomassie Blue.