Active human RSPO3 protein fragment

Name Active human RSPO3 protein fragment
Supplier Abcam
Catalog ab174048
Category Protein
Prices $372.00
Sizes 50 µg
Applications SDS-PAGE FA
Species Reactivities Human
Nature Recombinant
Source HEK 293 cells
Tag/Conjugation His tag C-Terminus
Purity >95% by SDS-PAGE .
Bioactivity Measured by its ability to induce activation of beta-catenin response in a Luciferase assay using HEK293T cells. The ED 50 for this effect is typically 0.5 - 2.0 ng/ml in the presence of 5 ng/ml recombinant Wnt3a.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession Q9BXY4
Gene RSPO3
Residue 22 to 146
Sequence QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMK QIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLH LGKCLDNCPEGLEANNHTMECVSIV
Supplier Page Shop

Product images