Active human RSPO3 protein fragment
| Name | Active human RSPO3 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab174048 |
| Category | Protein |
| Prices | $372.00 |
| Sizes | 50 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its ability to induce activation of beta-catenin response in a Luciferase assay using HEK293T cells. The ED 50 for this effect is typically 0.5 - 2.0 ng/ml in the presence of 5 ng/ml recombinant Wnt3a. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q9BXY4 |
| Gene | RSPO3 |
| Residue | 22 to 146 |
| Sequence | QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMK QIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLH LGKCLDNCPEGLEANNHTMECVSIV |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of RSPO3 in reducing conditions. Gel stained overnight with Coomassie Blue. Protein migrates as 18 kDa and 24 kDa due to different glycosylation.