Active human TIM 3 full length protein
| Name | Active human TIM 3 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab155742 |
| Category | Protein |
| Prices | $352.00 |
| Sizes | 100 µg |
| Applications | ELISA SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . ab155742 was lyophilised from 0.22 µm filtered solution. |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilised recombinant Human Galectin-9 at 500 ng/ml can bind recombinant Human TIM 3-Fc with an apparent KD <30 nM. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q8TDQ0 |
| Gene | HAVCR2 |
| Residue | 22 to 142 |
| Sequence | SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTD ERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDE KFNLKLVIKPGEWTFACHLYE |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab155742 stained overnight with Coomassie Blue.