Human Rsk 2 / MAPKAP Kinase 1b protein fragment
| Name | Human Rsk 2 / MAPKAP Kinase 1b protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab159430 |
| Category | Protein |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | P51812 |
| Gene | RPS6KA3 |
| Residue | 2 to 95 |
| Sequence | PLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIA ITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQ |
| Supplier Page | Shop |
Product images
ab159430 on a 12.5% SDS-PAGE stained with Coomassie Blue.