Active human TNF Receptor I protein fragment
| Name | Active human TNF Receptor I protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab174046 |
| Category | Protein |
| Prices | $357.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | > 98 % by SDS-PAGE. |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized Human TNF alpha at 10 μg/mL (100 μl/well) can bind biotinylated ab174046. The EC 50 of biotinylated ab174046 is 0.2 μg/mL. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P19438 |
| Gene | TNFRSF1A |
| Residue | 22 to 211 |
| Sequence | IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYND CPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDR DTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAG FFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis ofab174046 in reducing conditions. Gel stained overnight with Coomassie Blue. DTT-reduced Protein migrates as 50-60 kDa due to different glycosylation.