Active human TNFRSF14 protein fragment
| Name | Active human TNFRSF14 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab155629 |
| Category | Protein |
| Prices | $352.00 |
| Sizes | 200 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its ability to inhibit TNF-beta-mediated cytotoxicity using L929 Mouse fibrosarcoma cells. The ED 50 for this effect is typically 2.5-10 µg/ml in the presence of 1 ng/ml of recombinant Human TNF-beta. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q92956 |
| Gene | TNFRSF14 |
| Residue | 37 to 202 |
| Sequence | PALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAH LNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCA ACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCS WLVTKAGAGTSSSHWV |
| Supplier Page | Shop |
Product images
SDS-PAGE of reduced ab155629 stained overnight with Coomassie Blue.