Human Serglycin full length protein
| Name | Human Serglycin full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab184593 |
| Category | Protein |
| Applications | MS SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >95% by SDS-PAGE . |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P10124 |
| Gene | SRGN |
| Residue | 28 to 158 |
| Sequence | MKHHHHHHASYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKI PRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEME QDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML |
| Supplier Page | Shop |
Product images
The purity of ab184593 was determined by reduced and boiled Serglycin at 2.5 µg/lane (lane 1) and non-reduced and non-boiled Serglycin at 2.5 µg/lane (lane 2) by SDS-PAGE.