Active human TSLP full length protein

• Supplier: Abcam
• Catalog: ab201363
• Category: Protein
• Prices: $101.00
• Sizes: 2 µg
• Applications: FA HPLC SDS-PAGE
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: > 98 % by SDS-PAGE. > 98 % by HPLC analysis.
• Bioactivity: Fully biologically active when compared to standard. The ED 50 as measured by its ability to induce proliferation of Human IL-7Rα and Human TSLP R co-transfected mouse BaF3 cells is less than 0.3 ng/ml.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: Q969D9
• Gene: TSLP
• Residue: 29 to 159
• Sequence: MYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLT EIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKR RKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ