Active human UCHL3 full length protein
| Name | Active human UCHL3 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab103502 |
| Category | Protein |
| Prices | $239.00, $883.00 |
| Sizes | 100 µg, 500 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 95 % by SDS-PAGE. ab103502 purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA. |
| Bioactivity | Specific activity: >3,000 pmole/min/ug. Measured by the hydrolysis of Ubiquitin-AMC at pH 8.0, at 37°C. Activity Assay: Prepare a 100ul of recombinant UCH-L3 protein with various concentrations (0.48ng, 0.9ng) in assay buffer and equilibrate to 37°C for 10 minutes. (Assay buffer: 50mM Tris-HCl, 0.5 mM EDTA, 1 mM DTT, 0.1 mg/ml Ovalbumin, pH 8.0.) Add 50ul of 1uM Ubiquitin-AMC. Read at excitation wavelengths 355nm and emission 460nm for 5 minutes. - Ubiquitin-AMC - 96 Well Polystyrene Microplate, black - Fluorescent plate reader (PerkinElmer, VICTOR X3) |
| SwissProt/Accession | P15374 |
| Gene | UCHL3 |
| Residue | 1 to 230 |
| Sequence | MGSSHHHHHHSSGLVPRGSH MEGQRWLPLEANPEVTNQFLKQLGLHPNWQ FVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDV TSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMS PEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of 3µg ab103502.