Human SRD5A2 protein fragment
| Name | Human SRD5A2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114946 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P31213 |
| Gene | SRD5A2 |
| Residue | 28 to 65 |
| Sequence | AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab114946 at approximately 29.81kDa. Stained with Coomassie Blue.