Active human VEGFA protein fragment
| Name | Active human VEGFA protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab155722 |
| Category | Protein |
| Prices | $239.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . ab155722 was lyophilized from 0.22 µm filtered solution. |
| Bioactivity | The bio-activity was determined by dose-dependent stimulation of the proliferation of HUVEC cells. The ED 50 <1ng/ml, corresponding to a specific activity of >1X10 6 Unit/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P15692 |
| Gene | VEGFA |
| Residue | 207 to 327 |
| Sequence | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab155722 staining overnight with Coomassie Blue, (+) reduced and (-) non-reduced.