Active human VEGFC full length protein
| Name | Active human VEGFC full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab155739 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | > 97 % by SDS-PAGE. |
| Bioactivity | Measured in a cell proliferation assay using HMVEC human microvascular endothelial cells. The ED 50 for this effect is typically 0.15-0.7 µg/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P49767 |
| Gene | VEGFC |
| Residue | 103 to 227 |
| Sequence | TEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFF KPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTIS FANHTSCRCMSKLDVYRQVHSIIRR |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab155739 stained overnight with Coomassie Blue.