Name | PAXIP1 fusion protein |
---|---|
Supplier | Proteintech Group |
Catalog | Ag4567 |
Category | Protein |
Prices | $199.00 |
Sizes | 50 μg |
Species Reactivities | Human |
Source | E. coli -derived, T-HIS |
Tag/Conjugation | 6*his |
Purity | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Bioactivity | Not tested. |
Endotoxin | Please contact the lab for more information. |
Gene | PAXIP1 |
Sequence | CENDLHLCREYFARGIDVHNAEFVLTGVLTQTLDYESYKFN (717 - 1069 aa encoded by BC033781 ) |
Supplier Page | Shop |