Human TIMM8A full length protein
| Name | Human TIMM8A full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab174417 |
| Category | Protein |
| Applications | SDS-PAGE MS |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >90% by SDS-PAGE. ab174417 was purified using conventional chromatography. |
| SwissProt/Accession | O60220 |
| Gene | TIMM8A |
| Residue | 1 to 97 |
| Sequence | MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDK PGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of ab174417 (3 µg)