| Name | Active mouse EGF full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191769 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 500 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The ED 50 was determined by a cell proliferation assay using balb/c 3T3 cells is ≤ 0.1 ng/mL, corresponding to a specific activity of ≥ 1.0 x 10 7 units/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P01133 |
| Gene | EGF |
| Residue | 977 to 1029 |
| Sequence | NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWW ELR |
| Supplier Page | Shop |