Human TRIM72 protein fragment
| Name | Human TRIM72 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112438 |
| Category | Protein |
| Applications | ELISA SDS-PAGE Array WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | This product is useful for Antibody Production and Protein Array |
| SwissProt/Accession | Q6ZMU5 |
| Gene | TRIM72 |
| Residue | 378 to 477 |
| Sequence | QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFY DASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAE |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab112438 at approximately 36.63kDa stained with Coomassie Blue.