Active mouse Exodus 2 full length protein

Name Active mouse Exodus 2 full length protein
Supplier Abcam
Catalog ab201361
Category Protein
Prices $101.00
Sizes 5 µg
Applications FA HPLC SDS-PAGE
Species Reactivities Mouse
Nature Recombinant
Source E. coli
Purity > 97 % by SDS-PAGE. > 97 % by HPLC analysis.
Bioactivity Fully biologically active when compared to standard. Determined by its ability to chemoattract total murine T cell population using a concentration range of 10.0 -100.0 ng/ml.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession O00585
Gene CCL21
Residue 24 to 133
Sequence SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPE LCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCK RTEQTQPSRG
Supplier Page Shop