Human TYK2 protein fragment
| Name | Human TYK2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112369 |
| Category | Protein |
| Applications | SDS-PAGE WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | useful for Antibody Production and Protein Array |
| SwissProt/Accession | P29597 |
| Gene | TYK2 |
| Residue | 276 to 375 |
| Sequence | PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQ WWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAVGQPADRPREPLWA |
| Supplier Page | Shop |
Product images
ab112369 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.