PLA2G12 Human

• Supplier: NeoScientific
• Catalog: ENPS-337
• Category: Protein
• Prices: $65.00, $169.00, $5,070.00
• Sizes: 2 µg, 10 µg, 1 mg
• Species Reactivities: Human
• Source: Escherichia Coli.
• Purity: Greater than 95% as determined by SDS PAGE.
• Gene: PLA2G12A
• Description: Secreted Phospholipase A2-XII Human Recombiannt was produced with N-terminal His-Tag. PLA2G12 His-Tagged Fusion Protein is 20.6 kDa containing 167 amino acid residues of the human secreted phospholipase A2-XII and 16 additional amino acid residues – His-Tag (underlined).MRGSHHHHHHGMASHMQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL.