Active mouse IGF1 protein fragment

• Supplier: Abcam
• Catalog: ab9861
• Category: Protein
• Prices: $110.00, $257.00
• Sizes: 10 µg, 50 µg
• Applications: FA SDS-PAGE
• Species Reactivities: Mouse
• Nature: Recombinant
• Source: E. coli
• Bioactivity: active
• Endotoxin: < 0.100 Eu/µg
• SwissProt/Accession: P05019
• Gene: IGF1
• Residue: 49 to 118
• Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPTKAA

Product References

Investigation of sequential growth factor delivery during cuprizone challenge in - Investigation of sequential growth factor delivery during cuprizone challenge in

Sabo JK, Aumann TD, Kilpatrick TJ, Cate HS. PLoS One. 2013 May 1;8(5):e63415.

Matrix IGF-1 maintains bone mass by activation of mTOR in mesenchymal stem cells. - Matrix IGF-1 maintains bone mass by activation of mTOR in mesenchymal stem cells.

Xian L, Wu X, Pang L, Lou M, Rosen CJ, Qiu T, Crane J, Frassica F, Zhang L, Rodriguez JP, Xiaofeng Jia, Shoshana Yakar, Shouhong Xuan, Argiris Efstratiadis, Mei Wan, Xu Cao. Nat Med. 2012 Jul;18(7):1095-101.

Down-regulation of manganese-superoxide dismutase through phosphorylation of - Down-regulation of manganese-superoxide dismutase through phosphorylation of

Li M, Chiu JF, Mossman BT, Fukagawa NK. J Biol Chem. 2006 Dec 29;281(52):40429-39. Epub 2006 Nov 1.