Human UHRF1 protein fragment
| Name | Human UHRF1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112411 |
| Category | Protein |
| Applications | WB ELISA Array |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | This product is useful for Antibody Production and Protein Array |
| SwissProt/Accession | Q96T88 |
| Gene | UHRF1 |
| Residue | 694 to 793 |
| Sequence | WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNV CKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE image, using ab112411. (Stained with Coomassie Blue)