Human YY1 associated factor 2 protein fragment
| Name | Human YY1 associated factor 2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab160835 |
| Category | Protein |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | Q8IY57 |
| Gene | YAF2 |
| Residue | 1 to 61 |
| Sequence | MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTST RKPRPVSQLVA |
| Supplier Page | Shop |
Product images
ab160835 on a 12.5% SDS-PAGE stained with Coomassie Blue.