Human Z DNA binding protein protein fragment
| Name | Human Z DNA binding protein protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab153529 |
| Category | Protein |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | Q9H171 |
| Gene | ZBP1 |
| Residue | 2 to 100 |
| Sequence | AQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYR MKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAKRPQQHAATIPET |
| Supplier Page | Shop |
Product images
ab153529 on a 12.5% SDS-PAGE stained with Coomassie Blue.