Active mouse LIF full length protein
| Name | Active mouse LIF full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab181971 |
| Category | Protein |
| Prices | $186.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | > 92 % by SDS-PAGE. |
| Bioactivity | Measured by the ability of ab181971 to inhibit the proliferation of M1 mouse myeloid leukemia cells. The ED 50 for this effect is typically 0.3-1.2 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P15018 |
| Gene | LIF |
| Residue | 24 to 203 |
| Sequence | SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGE PFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRD QKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDH SDKEAFQRKKLGCQLLGTYKQVISVVVQAF |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of DTT-reduced ab181971 stained overnight with Coomassie Blue. As a result of glycosylation, DTT-reduced protein migrates as 33-45 kDa.